SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CM93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CM93
Domain Number 1 Region: 55-186
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-29
Family Ankyrin repeat 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CM93
Sequence length 376
Comment (tr|H3CM93|H3CM93_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000009374} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
KPKGKRPCKTKHTEGSLVTKRRKWEEPKPRRTERDTNAKPPASSAPADSTSCRPPTPLHT
HPTRQIPPEVRRLIVNKNAGETLLQRAARLGYQDVVLYCLEQQICDVNHRDNAGYCALHE
ACAHGWLGIVRLLVEHGADVNCSAQDGTRPLHDAVENDHVEVARFLLACGADPTLTSYSG
RGPINMSHSATMETFLEDYLSDLQGRSEGDQGIFWEFYGSSVFESSNGGEVYNILADPPG
PDEEEDDEEDDDNRGQRARREVFEFELSDRPLLPCYNVQVSLSQGPRNWLLLSDVLGRLR
MTSRSFRRLFPQLNVQSVPEDEFYRQASLSQLLTGPDEQELASFRPDIKDPLELVEATPE
LAGMLGSSLEFVDTRY
Download sequence
Identical sequences H3CM93
ENSTNIP00000009374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]