SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CMH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CMH1
Domain Number 1 Region: 6-192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-36
Family SPRY domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CMH1
Sequence length 198
Comment (tr|H3CMH1|H3CMH1_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000009452} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
EPTCRADLIKHWVNLTLDDKTANKMLWITEGGAKVARMTDSVTCPVLDRPERYEYVPQVL
CKEGILGFRGYWEVEFTGWVVLGVAYERAARRNSDGPCGFGENEESWGLGWSGSSYNAWH
KSQTMEILEVPLCSTLGVYLDQPAGLLNFYTVEEVKEGEEGAGGKEVKLLHQVKSSFLGK
MIPGFWLGTQSHCLIKKK
Download sequence
Identical sequences H3CMH1
ENSTNIP00000009452 ENSTNIP00000009452 99883.ENSTNIP00000009452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]