SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CMQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CMQ0
Domain Number 1 Region: 246-286
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000776
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 2 Region: 330-369
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000277
Family Ovomucoid domain III-like 0.028
Further Details:      
 
Weak hits

Sequence:  H3CMQ0
Domain Number - Region: 207-234
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00184
Family PMP inhibitors 0.0037
Further Details:      
 
Domain Number - Region: 366-395
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00568
Family Ovomucoid domain III-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CMQ0
Sequence length 581
Comment (tr|H3CMQ0|H3CMQ0_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000009531} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSDFKLWSNGTIKMPYMNIPVLDIRKCLPDMWKAVACSLQIKPCHIKSRGSLICKSDCVD
ILTQCGDRRRFHEGQTPERICELLSPVDDPERCIPLHRYLGPSVLDSDRAEEVVHPCNPN
PCPSNHVCQVNRRGCLDALRCQPYICLGEASDFLVQLDARVQVPTRTGPAGCYEVCSCGP
SGRLENCVEMPCLDIHKPCVVGGQRRSPGSTFRVDCRLCSCLAGDSVCSRRRCLGSEGAQ
PQHLTGLPCDCPDRFVPVCASNGRNYPSACVARCLGFQDHQFVFGTCGMGNPAPASPAPG
TRGQCVPRHRVCLSDSSACPQYECVGRPGVCDRNGGELACDTDGVVHLSVCHLQQAGKRL
AYMGLCQEVCRKPQQVCGHNMETYNTVCHALADRVAVGLRGPLSRCGGPLGRGPGLCMQH
CLLSTAVLPWLPACDPPRGLFMLQILWNKEAMNTFSKLNKNRPETVQDVLQVLRLHVSVP
QCDVFGYLSIDHMLVVLVAPVERQPTPLQMEACSKEAEKIDSLINHASPTLVSHVPLSAF
LTSEIRTTSVHSSGGCPPSPLRPGLCFLLGLLSAAPLLQQL
Download sequence
Identical sequences H3CMQ0
ENSTNIP00000009531 ENSTNIP00000009531 99883.ENSTNIP00000009531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]