SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CMW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CMW4
Domain Number 1 Region: 17-174
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-28
Family C-type lectin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CMW4
Sequence length 257
Comment (tr|H3CMW4|H3CMW4_TETNG) Chondrolectin {ECO:0000313|Ensembl:ENSTNIP00000009595} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RCLPGQTVCLGDPQRPCYKIAYFQEVWSRVAFREASEACRMDGGSLLSIQSPGEQKDIEN
LLQEMRSGAVGGAGAAGGIADGDYWIGLVRVDDHAPAEAGSTSHSCSDLYRWTDGSPASF
RNWYFDEPSCGGEACVVMYHQPAALPGLGGAYLYQWNDDRCNMKHNFICKYHPEATAGGG
GVKPSTEDVPSQVTTAGSSGMLLLSVILPTIPLFLLILVASGTCCFQLLKRSSRAKTEVH
QPNLWISESPGGDTVEA
Download sequence
Identical sequences H3CMW4
ENSTNIP00000009595 99883.ENSTNIP00000009595 ENSTNIP00000009595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]