SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CN37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CN37
Domain Number 1 Region: 799-825
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000713
Family A20-like zinc finger 0.02
Further Details:      
 
Weak hits

Sequence:  H3CN37
Domain Number - Region: 4-42
Classification Level Classification E-value
Superfamily UBA-like 0.00013
Family TAP-C domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CN37
Sequence length 827
Comment (tr|H3CN37|H3CN37_TETNG) OTU deubiquitinase 7A {ECO:0000313|Ensembl:ENSTNIP00000009668} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=OTUD7A OC=Tetraodon.
Sequence
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLSAALNDYEELRQVHTANLPQVFNEGR
YYRPPETRDTPTHVSKIDRPCAQKQEDNAQEKRLSRGISHASSAIVSLARLQVASECTNE
QFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQSTMMALEQAGRLNWWSTMCISCKKLL
PLATTGDGNCLLHAASLGMWGFHDRDLMLRKSLYTMMKSGAERDALKRRWRWQQTQQNKE
SGLVYTEEEWEKEWNELLKLASSEPRTHLSKNGTTSGGVDNTEDPVYESLEEFHVFVLAH
VLRRPIVVVADTMLRDSGGEAFAPIPLGGLYLPLEVPPSRCHCSPLVLAYDQAHFSALVS
MEQRDQQREQAVIPLTDSEHKLLALHFAVDPGRDWEWGRDDNDNTKLANLILSLEAKLNL
LHNYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLAESMDSDRESVGSNSNVNSGKPS
KEKDKDKQRKDKDKSRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMNKSNSGSGRS
GENGGEKIKKKESKATKGSKDDSGHSASSTSSERQDSAGRASGDKSLENWKYSTDVKLSL
NILRAAMQGERKFIFAGLLLTSHRHQFHEEMISYYLSNAQERFSQEQEQKRKEAEKKPPV
TGEVAVKKPELESVFQRERSNSSPPENSSPVLPHHTSQPTPGLKVQNDPYNKPVMGTLKT
CATYPQQNRTLSSQSYSPARLSGVRTVTTIDALAYNMPGEHKSHTYTNGFNAWLNQDKTK
GRSSGSPLYCFQQRRCKKENCSFYGRPETDNYCSYCYREELKRRERE
Download sequence
Identical sequences H3CN37
99883.ENSTNIP00000009668 ENSTNIP00000009668 ENSTNIP00000009668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]