SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CP19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CP19
Domain Number 1 Region: 160-274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-35
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 37-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 3 Region: 357-479
Classification Level Classification E-value
Superfamily TIMP-like 1.32e-30
Family Netrin-like domain (NTR/C345C module) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CP19
Sequence length 479
Comment (tr|H3CP19|H3CP19_TETNG) Procollagen C-endopeptidase enhancer b {ECO:0000313|Ensembl:ENSTNIP00000010002} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
EASGMEGRVWTLCVLVALRLGCTEAQAQSNYSRPTFECGGHLVTDSGIVASEGFPTPYKP
NSKCTWYITVPEGHVVMMSFRLFDLEADPTCRYDYLDIYNGHSRLVQKLGRFCGTFRPGA
LISTSNTMMLEMVSDEATGGRGFLAYFNAGKPHMEEDQFCGGRLTKTHGSVKTPNWPNSN
YPAGISCSWHISVPPSNVIEVKFEKLDLEPDTYCRYDYVALFNGGETDNSRRIGKFCGDR
APGVIVTNGNELLVQFVSDLSITSDGFLAHYSSVPRGTRTPTSTGDFIYGPQTTSIPQKP
SKPVKPSPKLKPKPAPKPTKKPPVKTPLKPPPRKPAAKPVKPTAKPKPAKPTRAAPANPL
CTQPCKRTGTLQSSYCPHDFVITGKVTAVLPGPSSAKVEVSLIKNYKPGRLSVTKSGPAT
SVTLTSTCKRCPGLTKGLNYVLMGGVDAQGNGVLTPASFTLLYKPVHAKALAALSRKAC
Download sequence
Identical sequences H3CP19
ENSTNIP00000010002 99883.ENSTNIP00000010002 ENSTNIP00000010002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]