SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CPP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CPP2
Domain Number 1 Region: 356-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-65
Family SPRY domain 0.00000475
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily RING/U-box 4.86e-20
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 3 Region: 140-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000118
Family B-box zinc-binding domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CPP2
Sequence length 546
Comment (tr|H3CPP2|H3CPP2_TETNG) Si:dkey-46i9.6 {ECO:0000313|Ensembl:ENSTNIP00000010225} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAATGNLSEEQVHCSICLDVFTNPVSIPCGHNFCQSCIIGYWKSSPLHQCPMCKKSFYKR
PDISVNTVLREIAEQFKEIRVLQGAVSEEGREKRWTREVLCDVCLGGGRPRAVKSCLVCL
TSYCEEHLRSHCARFTKHKLMEPVANMADRMCPKHERLLELFCKKDQTCVCVLCTETDHR
AHYTVPVEREWSEKKAQLKRTEIDVQQMIRDREKKMEEIKHSVELNKASAQREIEESVQV
FSELVRSIQRTQAELVVSIEEKQRQTERWAGGFVAELEQEVADLTRRKKELENMARTDHI
HFLKNFPALCTSPPVKDWSETNVPTDVCVGMIRKSVSKLEATLQEMIDKLAQSEIKKILE
YSVDVTLDPDSANPWLQLSQDRRQVRHLGAWQDLPDHPDRFDTVVIVLAREGFTSGRHYW
EVQVEVSNKNGWDLGVARGDASRKGQLVLNPENGYWATVHYEGEKYAALTTPPLPLSLKQ
KPEKVGVFVDYEEGLVSFYDVTAQSHIYSFTECSFDGRIFPYFSPHAKQDEKNEGPLIIS
SVKHCE
Download sequence
Identical sequences H3CPP2
99883.ENSTNIP00000010225 ENSTNIP00000010225 ENSTNIP00000010225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]