SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CQ01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CQ01
Domain Number 1 Region: 45-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-72
Family Lectin leg-like 0.00000000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CQ01
Sequence length 522
Comment (tr|H3CQ01|H3CQ01_TETNG) Lectin, mannose-binding, 1 {ECO:0000313|Ensembl:ENSTNIP00000010335} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAVSIARRPAANAPLLVLTFLTVLINHHSVADVPADASTPEEPPHRRFEYKYSFKGPHLS
QSDGSVPFWTHTGSAIPSADQVRITPSLRSQRGSIWTKNKVIFEHWEAEVTFRVSGRGRM
GADGLAVWFTTSQGLEGPVYGAADQWNGVGVFFDSFDNDGKKNNPAIIVVGNNGKLVYDH
QNDGTTQALGTCLRDFRNKPYPIRAKITYYKKTLTVMINNGFTPNKDDFEFCTKVDNMII
PTEGFFGISAATGGLADDHDVLSFLLFRLTEPGQQLSFQLKPPAESEIPKEEKDKYQEEF
QNFQQELDKKKEEFQKEHPDVQGEPIEDVYETASDREIRQVFEGQNQIHLEIKQLHRQLA
MILDEQRRYVSVITDEVVKKAASAAPGQVDSASQQQLGSVLATQQEVLQKLNELRNNFHE
SVKQIGSAQHQGSAGGLGTYETVQHFNDIKEHLHMVKRDVEHLVQRSAQNPAEKAVKCPE
LPPVPSCLSTIHFIIFIVIQSVLFFCYIMYKSQQEAAAKKFF
Download sequence
Identical sequences H3CQ01
ENSTNIP00000010335 99883.ENSTNIP00000010335 ENSTNIP00000010335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]