SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CQ02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CQ02
Domain Number 1 Region: 100-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000061
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 2 Region: 58-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000013
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CQ02
Sequence length 377
Comment (tr|H3CQ02|H3CQ02_TETNG) Collagen and calcium binding EGF domains 1 {ECO:0000313|Ensembl:ENSTNIP00000010336} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MWSFQDEDASHGREECSENNVSTTKYPCVKSTGEAATCYRKKCCKGFKFVLGQCIPEDYD
VCTGAPCEQQCTDHFGRVVCTCYPGYRYDRERHRNRQSPYCLDIDECADRNMSACSQLCV
NSVGSYRCECEKGYFLEEDRKTCTKGERAFFPNRCGHDSKSDNVMNAGTCSATCDDFLQI
KMSVLQLKQNMTVLSNSADVRRQMTRQKLLTSPVFLPGPPGLPGPPGLPGPPGGPGPEGP
PGLKGPPGLPGPRGLMGPMGPTPDLFHIKRGPRGPVGPPGAPGKNGLKGDRGAPGPTGPP
GPPGSFDFLLLLMAEIRNDISELQNKVYGRPVHSQGEDFPAAPDSWVDNQEYLDAGSGEN
YKEPPQKDGEGFKRSRK
Download sequence
Identical sequences H3CQ02
99883.ENSTNIP00000010336 ENSTNIP00000010336 ENSTNIP00000010336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]