SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CQ18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CQ18
Domain Number 1 Region: 61-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000215
Family EGF-type module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CQ18
Sequence length 186
Comment (tr|H3CQ18|H3CQ18_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000010352} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LETLRLLLFAFLTAALALCKHSLAGRNVTEGLANRTVSHCHHHSNGDNCTGNSGDLDPWH
GHFSPCPEELTGYCVHGDCRYLQDHKAPSCRCEHGFIGSRCEYLVLDWWRGEKQQIIIIC
IIAGLVLLILLILFICVCSNRRLRWRRRRRREALTDGTEKLSMMDKAGTRSAVSSDPTEP
QHVNAV
Download sequence
Identical sequences H3CQ18
ENSTNIP00000010352 99883.ENSTNIP00000010352 ENSTNIP00000010352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]