SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CQ45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CQ45
Domain Number 1 Region: 227-368
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-36
Family Third domain of FERM 0.00078
Further Details:      
 
Domain Number 2 Region: 119-229
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-33
Family Second domain of FERM 0.0000985
Further Details:      
 
Domain Number 3 Region: 41-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-24
Family First domain of FERM 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CQ45
Sequence length 739
Comment (tr|H3CQ45|H3CQ45_TETNG) Erythrocyte membrane protein band 4.1 like 5 {ECO:0000313|Ensembl:ENSTNIP00000010379} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MLSFLRRTLGRRSIRKHAEKTRLREAQRASTHIPAAGEAKSIITCRVSLLDGTDVSVDLP
KKAKGEELFDQIMYHLDLVEKDYFGLRFMDSAQVPHWLDVTKSIKKQVKIGPPYCLHMRV
KFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFDTAVELAAFSLQAELGDCDPLEHN
LDLVSEFRFIPQTEEVELAIYNAWKECRGQTPAQAEINYLNKAKWLEMYGVDMHMVKARD
GNEYSLGLTPTGVLVFEGATKIGLFFWPKITCLDFKKSKLTLVVVEDDEQGKEQEHTFVF
RMDHPKACKHLWKCAVEHNAFFRLRGPVQKNSARSGFIRMGSRFRYSGKTEYQTTKASKA
RRSASFERRPSRRYSRRTMQNRGENTRGKGNGVSSSKDKPSFIRGAWSAVPVVSPVAASA
CGPMEIEALPRSPGPRKEKDGGEKLPLSGAVTRNERSGACRAGSVNTDLTKAVRPQSLGI
CPVATRTAVKTDPGFTCENISEAAARLKQLELEISPLPVTPRNNINVNVALNNQEDVVKI
TEKCSLSSTASSSPGATPLRTPEDLKSNILKAQAEAAAVMAPSEEHVVIVGDKNCNVQDA
SVRKVIVNSCCKTSLVTCVSLQVKGARRLKRRTLTRRVLLLSLSTNLDGDTFLFFQLPPV
HQPKPVITPRWIIPTTATWTNQLRSTLFSLQTGGQLTPQPSPISPPHLTLSSAVSHSAVG
QHPTPEDGARPRGLLTTEL
Download sequence
Identical sequences H3CQ45
ENSTNIP00000010379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]