SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CQU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CQU2
Domain Number 1 Region: 24-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-24
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 2 Region: 232-436
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-23
Family Laminin G-like module 0.0069
Further Details:      
 
Domain Number 3 Region: 632-673
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000298
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 549-589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 478-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family EGF-type module 0.022
Further Details:      
 
Domain Number 6 Region: 602-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000516
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  H3CQU2
Domain Number - Region: 515-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000191
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CQU2
Sequence length 710
Comment (tr|H3CQU2|H3CQU2_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000010626} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
ANVTAGCSDRDKCEDNPCRNRGRCWRSYVCECLRPYEGSDCAEDAEYVTARFGNNGEESY
AVFSLDDDPGPTATVSMFIRTRRPSGLLLVLANSTSQYLRLWLEDGRVKVQVNTFETFWG
RGRVDDGHVHLLSLRLEATECFLFLSAQSQGSLRIRPIRAQTGDQVLVGGLPDARASAMF
GGYFKGCVQDLRIDSKRLQFFPLAPPVESYRLEKLAGVAQGCSGDDACAAEPCLNGGVCY
SMWDDFICNCPPHTAGQRCQEVKWCELSPCPDATTCQPRSQGFECVSNATFRFESGVFRY
RSSGRIRRRLASVSLSFRSRQPNATVLHAHKDAHHLTLSLLDSHLVMELRAGTQGATLRS
RAPLSDGRWHRVELRLEEPALPASGWVMAADGEEESRSASAASAGELEFVTEGADVVLGG
LGWEAGASFSGCLGPVEIGGLLLPFHLHSELKLPRPQEEAFTLASGGSAPRRGCWGARVC
APDPCQNDGACEDLFDLHRCRCPPQWTGPVCREPADPCVSGPCVHGNCTNLPAGGFGCAC
QAGHSGERCEVEVDACQDSKCVNGATCLKGVQSYSCLCPQNLTGQYCRLPLLPAARCRGA
RWNYSCFNGGNCSGLDGCDCLPGFTGHWCEKDVDECASAPCMNGGFCLNYVNSFECVCDL
NFSGVHCQMDVSDFYLYVFLSLWQNLFQLMSYLVIRLDDEPEIDLGFQLD
Download sequence
Identical sequences H3CQU2
99883.ENSTNIP00000010626 ENSTNIP00000010626 ENSTNIP00000010626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]