SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CR24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3CR24
Domain Number - Region: 327-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00144
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CR24
Sequence length 870
Comment (tr|H3CR24|H3CR24_TETNG) Si:ch211-252f13.5 {ECO:0000313|Ensembl:ENSTNIP00000010708} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MASVCILFLLWATCMLSEEAVSETCRGTRCFPDPDWIGPCVGAHCQGLRDAASSRTFPNS
AQPRPVRVYPSFQQDARFSPYQGQSAPLAPYAVVQAQQAVPDARRTNPKTLTADVAHPCA
GGTCPPADGDDTAARGCKGVGCKLPGRMRHKPKPCVGNGCGAHAEELGRGGAAPVHVRDT
AAQFLSEFGSETGAWIQLTCDMKAGANDVPSEDALVLQLQLSEDQKDLVEALKSQQEEVR
ELQRLLGEQQGTLLLQQREILEQQRSMFEQLEDVKSHYNLMMETIKQTSFQNIQGDLGGH
VETPSVRDGAGNAQQALALHKVDMEASVMEDRDECLEIPGLCRDQQKCLNTPGGFRCPGM
TEHDAFSGLCGHGYFFNAAVDECQACNDCDGEPAASPCTANADTVCSGAAASAAPEAALS
LSWAGDVSLPGAEGHTLAHFSHGAQLHVSGRSDSALVAVEKGRLVLRQHGLVWLDENLSV
HHGCRSFIQACLRLNSTHGSEGRHLSGVRVEQQDARSFQSASISGVAEVAPGDLISLSVR
SASQHCNDSSEGVQLFHHSAASLSLLWLSHDTGAVAMTAQAAVSAHYHTNHRLAFRTTYT
SDPYVVGLTHDGRGIRFAESGAVRFVFQQALYSMGHACVSEGFQVLAYLNHNGTGSELCR
SFRPGVHYRDTSLSLSGAATVAPGDTLLLEILSPPQCNVRFFGDETGISALSLVWVPAAL
SSSLSASVSNASLPSGAVRNKPLFFRQTTAGVAQMDLQGRGSAGHRRDVVFRESGTASVA
LDLKLIHSCNLVKVTLLRRGAAEGARPVPLAQQVEGQMPEGSRYARVSLRASFQVHNGTA
VFFTLDCVRGRVNQISHQSGSGVSILWVAA
Download sequence
Identical sequences H3CR24
99883.ENSTNIP00000010708 ENSTNIP00000010708 ENSTNIP00000010708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]