SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CR51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CR51
Domain Number 1 Region: 565-800
Classification Level Classification E-value
Superfamily vWA-like 3.06e-33
Family Integrin A (or I) domain 0.0052
Further Details:      
 
Domain Number 2 Region: 29-232
Classification Level Classification E-value
Superfamily vWA-like 2.52e-31
Family Integrin A (or I) domain 0.009
Further Details:      
 
Domain Number 3 Region: 809-995
Classification Level Classification E-value
Superfamily vWA-like 8.46e-30
Family Integrin A (or I) domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CR51
Sequence length 1010
Comment (tr|H3CR51|H3CR51_TETNG) Collagen, type VI, alpha 1 {ECO:0000313|Ensembl:ENSTNIP00000010735} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
METLRGLLALLCVFLAGTHAQNREANNFAECPVDLFFVLDTSESVALRQKPPGYYIDQIK
TFTTNFIDELKNIRRHQCDRILTWNSGALHYSDEVILVGELMDMQTQRSTLKTSISGIEY
IGKGTYTDCAIKRGLSELLIGGSHYHENKYIVVVTDGHPLTGYKEPCGGVQEAANEARQH
GVKVFAVAISPDQEDTRLSLIATDHNYRQNFTAADDSKITKMDTIHTIINMITNETRDTC
CSFDCNAAGGPKGPDGDLGSKGERGRPGMPGEKGDIGNMGSIGDPGPPGYSGMKGDRGPR
GEKGERGHKGYKGDKGQRGRDGVDGRKGEAGFPGLPGCKGSPGGDGLRGEPGPKGDPGSF
GVKGSKGDPGRNGEPGRSGNYGPQGPQGDRGPPGNNGDKGERGDDGPAGQDGPRGERGII
GEKGEQGARGNRGPRGDPGDPGPRGELGREGSTGANGDPGDPGKAGAAGYRGDEGPPGPE
GPKGQRGVKGSAGDRGPMGPPGDVGIPGNGTAGCPGFQGHPGSRGDTGEPGLKGTPGPKG
DDGDAGDPGPDNSQPGAPGHKGAKGHRGPEGKRGPPGPPGPPGTDECEILDIIMKLCSCC
ECKCATLDLAFIVDSSESIGSTNFALAKDFIIAVIDRLAKDQQVKFAGNDSRVSVVQYSG
ARAQEVVQLGVNVNSITDFKQAVKDLRWLAEATYTGEALEFALKNTIRLMRQENRVVLVL
TDGRSDTDRDQVPLNVLCGNNVRVGGLGVKDYSGRRPNQEQLEDVVCKNDPKPGFSLVLE
NFAELLDDTFLQNLTSQICQDKKCPDYKCPISFTRSADILVMMDSSASVGQKNFETSKKF
VRLLAERFLSAERQGGASVRVGLAQYSRIARLEAELTNNLTHLVHHTEQAAFQNDGTNVL
GAMEYAIRSLEGRGDTSGGRKKLVLFSDGRSQAITEALLEKRAREVADAGVEVFVIAVGN
QVNEANLRTLVSRGRQDDISFAQRHLFRVPDYASLLRGVFHQTVSRRVSL
Download sequence
Identical sequences H3CR51
ENSTNIP00000010735 99883.ENSTNIP00000010735 ENSTNIP00000010735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]