SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CRD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CRD4
Domain Number 1 Region: 24-121,165-419,529-632
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.58e-38
Family LacY-like proton/sugar symporter 0.049
Further Details:      
 
Domain Number 2 Region: 446-486
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000132
Family Ovomucoid domain III-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CRD4
Sequence length 668
Comment (tr|H3CRD4|H3CRD4_TETNG) Solute carrier organic anion transporter family member {ECO:0000256|RuleBase:RU362056} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
PASSTCSWASVTPACSRPPPAPDSRCFLFCMCYLTFIQSLMVSGYLSSVITTIEKRYSLR
SSESGLLVSCFDIGSLLVVVFISYFGGRGQRPRWLAVGGVFIAVGAALFSLPHFISPPYQ
IQEVNSSSANEGLCSSSNASKDQVDVASCPRDQEGNEHHLYVALFIVAQILVGMGSTPIY
TLGPTYLDDNVKKENASLYLAIMYVMGALGPAAGYLLGGVLIGFYVHPKTVVGIDQSDPR
FIGNWWSGFLLCSLAMLLVIFPMFAFPKKLPPRHKKKKRRKKLSLDDMSSEDDVLKEKSS
NKSQPVSSSMGFGKDMRDLPRAAVRILSNVTFLFVSLSYTAESAIVTAFITFIPKFIESQ
FGIPASSASIYTGLIIVPSAGVGIVLGGYIIKKLKLGARESAKLAMICSGVSLLCFSTLF
IVGCESINLGGINIPYTTGPTLTMTQRNLTGGCNVNCGCRIHEYAPVCGSDGITYFNPCL
AGCRGVANDSSGGRNYSDCACVQSRQENGYAPWRWKCDRTCSTLIPFLIFLFIVTLITAC
AQPSAIIVTLRSVAEQERPFALGMQFVLLRTLAYIPTPIYFGAVIDTTCMLWQQDCGVHG
SCWEYDVTSLRFVYFGLAASLKFLGFLFIFLTWYSINSTVTAQRGRSSTLTSHTHTCPTP
TPARQHVP
Download sequence
Identical sequences H3CRD4
ENSTNIP00000010818 ENSTNIP00000006882 99883.ENSTNIP00000010818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]