SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CRL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CRL8
Domain Number 1 Region: 129-338,490-604
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.16e-63
Family Diacylglycerol kinase-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CRL8
Sequence length 612
Comment (tr|H3CRL8|H3CRL8_TETNG) Sphingosine kinase 2 {ECO:0000313|Ensembl:ENSTNIP00000010902} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VSRPPLRAAAAASPGFSGTHGSFPRKPLVVRGAHKQRLSPRPGKEARLMLPLAELVGCSC
PRAPAPPLLVLYWYPPGKRRKGVSRRRQVRAFLAESRAEAERWAAAVQCLLRDVIVTSDT
EFSRRLLPRPRRLLLLVNPFSGRGQAMQWCQTQILPMIKEANISYNLIQTERQNHARELI
REISLPEWDGIVIVSGDGLLHEVINGLMERPDWEQAIKIPVGILPCGSGNALAGSINHNA
GYDMCLRESLLLNCCFLLCRGGVRPMDVVSVTTSPPPSSNNHTAPPRRLFSFLSVAWGFV
SDVDIESERYRGLGSARFTLGTLVRIASLRSYKGRLSFLPPTSCTSSPDATPPPPRRTIS
RSITEGLEGLCHTPIHRTCSDMGISEQRSLRLAAEEPVWSGTSSESNEREDGSLGGAERR
SPTSWTWPVSERSPSPLLFATLPSPTSPSPWTKTRTRGQGPQRHRQFCLPLNLPKDDLLP
PLDQPLPTRDWVTIEGDFVLVLALYQSHLGADLFAAPQARFDDGLIHLTFVRAGISRATL
LRLFFAMERGTHHSVSSPYVSHVTCKAFRLQPLSTRGTLTVDGELVYGPLQAQVHPSLAR
LIVGDSGSKGRG
Download sequence
Identical sequences H3CRL8
ENSTNIP00000010902 99883.ENSTNIP00000010902 ENSTNIP00000010902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]