SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CRS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CRS5
Domain Number 1 Region: 12-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.63e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00046
Further Details:      
 
Domain Number 2 Region: 758-931
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.81e-35
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 939-1151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-30
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 4 Region: 550-608
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000628
Family Fibrinogen C-terminal domain-like 0.0036
Further Details:      
 
Domain Number 5 Region: 522-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000571
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CRS5
Sequence length 1304
Comment (tr|H3CRS5|H3CRS5_TETNG) Contactin associated protein like 2 {ECO:0000313|Ensembl:ENSTNIP00000010959} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=CNTNAP2 OC=Tetraodon.
Sequence
AEKCDEALASSLPHTAFTSSSVFSNGYAPGYAKLNRRGEGAGGWSPLDSDHYQWLQVDLG
SRKQVIAIATQGRYSSSDWTTRYRLLYSDTGRNWKPYHQDGNIWAFSGNSNSESVVRHEL
QQGTVVRFLRFVPLEWSEEGRIGLRIEVYGCSYCEDINMSSLPESSSKTVNQTKKWCLDI
NLMKVSDFQTTTTLFAGKPEPDKTQVLKYIKAELIVPIGNSSIPHSCLMIKLSLALSSAF
SQKKRCIVICLQLLPNPQLSISPNIRSFRILFFPEMEEFRFGQHYLKANEEESTQKRRRI
FMKSAPSGNGGSIFAFLANRSLTVTKSGSTGSFNSLELQSFPIWITHNVAQQCVGSMCLD
ALAASKRALDDMSNGLLGDLPPKLDWGISQLFSSPRCHVRHWLHRHMMSQRCPIAFREAG
GATQSHQRLPHSGSADTVVLSCTRKKKSRVLNHPFQAPSNELLFFGWLINVHGQSNKIEY
KICHEGVKKLGEEAGTPAAFHLIYLFQHNNFHSGLLMCYIRKKCMPNHCEHGGRCKQSWD
SFSCTCDGTGYTGATCHTSIYEPSCEAYKHLGRSSDTYWIDPDGSGPLAPFKVSCNMTED
KVWTTVMNNLPAKTTITGSSKEKRTVLQVNYSASMDQVTAITTSAESCEQHISYSCRMSR
LLNTPDGTPFTWWVGQGNEKHFYWGGSAPGIQKCACGMDRNCTDTKYDCNCDADHNLWRE
DSGLLGYKEHLPVSQVAVGDTNRPGSEAKMTVGPLRCQGDSDYWNAASFTTPSSYLHFAT
FQGETSADISFYFKTSAPYGVFLENLGNTDFIRLELKSPKVVSFSFDVGNGPVELTVHSG
TPLNDDQWHQVMAERNVKEAVLQLDQMYRAVRLAPAQGHTRLELFSQLYVGAAGGQRGFL
GCIRALRMNGVTLDLEERAMVTPGVKPGCQGHCTSFGMYCRNGGKCVEKYNGYLCDCSAT
AYDGPFCTRDIGGFFEAGTLVKYNFLPEAVAGASRDAKTLHHQPKAHGVNLTTEDVAFSF
STSSAPAVLMYISSKTEDFMAVLLRQNGSLQVRYNLGGLKAPFSIDVDQRNLANGQPHVF
NMSRVDRSITIQLDHYPPVSYTLPDASDTHFNLVKTLFLGKVFETGHVDPLVIEQYNTPG
FVGCLSRVRFNGIAPIKSALRAAAPTATQPGGEPAAAASPVSYQGKLVESNCGASPLTIP
PMSAATDPWRLDSTDAEFPFNEERVIPDGVNRDSAIIGGIIAVVIFTILCTLVFLIRYMF
RHKGTYHTNEAKGSGESAGESADTAIIGTDNPETIDESKKEWFI
Download sequence
Identical sequences H3CRS5
ENSTNIP00000010959 ENSTNIP00000010959 99883.ENSTNIP00000010959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]