SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CS19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CS19
Domain Number 1 Region: 6-92
Classification Level Classification E-value
Superfamily E set domains 8.26e-16
Family Other IPT/TIG domains 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CS19
Sequence length 924
Comment (tr|H3CS19|H3CS19_TETNG) Exocyst complex component 2 {ECO:0000313|Ensembl:ENSTNIP00000011053} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSPARQPPLVTGISPKEGVAWTKVTIRGENLGTGPADLIGLSICGHNCLLTAEWMSASKI
VCRVGPAKDDKGEIIVTTKSGGLGTSTVSFKLLRPERIGILDQSAVWVDEMNYYDMRTNR
NKGISPLSLRPSNPLGIELDKGKIPQKDMELIFPGMSGDFTSENFSATWYLIENHSESSF
EQLKVAASNLKKQATKKNEGSLAYVKGGLSTFFEAQDALSAIHQRLESDGTERVGGSMTQ
RLENILNRASDTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VLINDYEKAKSLFCNTEVPFFNKVYSLVETRIQALRHLCCDNHIPLYSSVHSYLCICRYL
SDLHAPGDPAWQCICAQQKWILQLMQNCRDEFISGQRVSVGALDLDGDTRPSALGRLSHA
TSLKRGGSLRIPRSNTWHYETPQRVQFVEKLSDVVIGQLPNFWKLWISYVNGSLFSETGE
KSGQVEKSKKNARQRQNDFKKMIEEMTHRLVKLVRGALLPTTLPKSEQNLYGGWDNKTDL
SGNWLTQIMHTVRACHEALSALEIPNDLLQVIQDLLLSLRVHCLMVTLEHTAEDVKTLAE
KEDWVVDNEGITSLPSQFEQCLVQMLQSLKEPLEVKPGEINVLQLERVQVQTTELIVKIL
KVFINCLEQLSIRTDRDMDLSHDISVDLSSPDRFPGIQEGFSPTPEQRLLIILSNCQYLE
RRTILNLADHFEKHGFAGTEKITQISVEAVRQLDKNLFEAYVERRADPIAGSLEPGIYAG
YFDWRDCQTPTASGVRNYLKEALVTIITVHAEVFTVSQDLVPRVLSKIIESVADEMCRLM
QCVSSFSKNGALQARLEICALRDAVSTYLNPESIASFKLALDALPQLHSGADKKLLEELL
NKFKSSMQLQLTCFRPCCVQPVKR
Download sequence
Identical sequences H3CS19
ENSTNIP00000011053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]