SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CSE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CSE0
Domain Number 1 Region: 180-268
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.35e-23
Family Thyroglobulin type-1 domain 0.00029
Further Details:      
 
Domain Number 2 Region: 24-109
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.18e-23
Family Growth factor receptor domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CSE0
Sequence length 282
Comment (tr|H3CSE0|H3CSE0_TETNG) Insulin-like growth factor binding protein 2a {ECO:0000313|Ensembl:ENSTNIP00000011174} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MLLYAGCSLLILSASLAGASLAEMVFRCPGCTAERQALCPKLTETCAEIVREPGCGCCPV
CARQEGEMCGVYTPRCATGLRCYPTPNSELPLEQLVQGQGQCRRKVDTEAATYSQEQREQ
TSGEVVEPPPELGVSDLPAIRKPSKDAAWMGPKESAVRQHRQELKTKMKTNKVEEVKTSR
PKQTLCQQELDQILERISKMPFRDNRGPLEDLYALHIPNCDKRGQYNLKQCKMSLHGQRG
ECWCVNPHTGRPIPSAPTVRGDPNCSQYLTELELDLPDLAQI
Download sequence
Identical sequences H3CSE0
99883.ENSTNIP00000011174 ENSTNIP00000011174 ENSTNIP00000011174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]