SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CSH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CSH1
Domain Number 1 Region: 17-128
Classification Level Classification E-value
Superfamily Prefoldin 4.18e-20
Family Prefoldin 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CSH1
Sequence length 497
Comment (tr|H3CSH1|H3CSH1_TETNG) URI1, prefoldin-like chaperone {ECO:0000313|Ensembl:ENSTNIP00000011205} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VMTMAEKDHTNIDNLDGVVRLRKEQEKVVKDCETKIQHWKKVSDDYEALNERLQTLPDQL
SYDIMVPFGSLAFMPGKLVHTNEITVLLGDNWFAKCSAKQAQKLVAHRMEHVKKELDDLS
KTRNNFAARVEFAKKMETATAMKGDFVDIREVENNDAVVTKEGTRRIAHRPNSKPKLDAV
LDLKKEDEEGDDGGGGKGILTEEELWARLDELEKLEALQDERDRLSDNADMNGEDTSSLS
SEEEKDGARPVNEQSLKPSWMSLPQSQAPASADSNDGGEGSCLPTIFFSHTVEPKKVRIN
TGKNTTLKFSERKEQKEHSKRKKKNGHSNGHAHHELHKITTPADIYRLFVDVRNGELFPR
KSILKSRSRENSVCSDTSESSAADFEERRVMGRGLSHEDATHSDTSDGITEEDSPGAAPT
PTPMHAHAHTASRFEAFSGTVVEKDPMPLTVPHLTIAPPALPTILERKQEEVAPDAPPPQ
QAPKRVSKFKAARLHQN
Download sequence
Identical sequences H3CSH1
ENSTNIP00000011205 ENSTNIP00000011205 99883.ENSTNIP00000011205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]