SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CSP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CSP0
Domain Number 1 Region: 160-335
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-50
Family SPRY domain 0.0000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CSP0
Sequence length 338
Comment (tr|H3CSP0|H3CSP0_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000011274} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
EISAMLEPLKKQLRKLDKTREQWEETRTYIQTQAVENEKAIREEFDKLHSFLVEEERNRL
KVLRQEEEIKKQVMTEKLKTLTEKIESLSATISDVETTLKEKDLPFLMMLAEKHNLCPCF
RARCSLHEPECIRDILINSAKHLGSLRFGVWNKMVASVKCAPFVLDPNTAQSNLRFSEEL
TCVQYSSKRALPDNPERCTSRVCVLGATGFTSGKHSWTVDVGQGKDWYIGAAAESIKRKT
AVFLNPAEGFWVIGLCNGDTFWAQTAPRVKLALKQKPERITVKLDYDKGKVVFINAEDST
TIHTFSDKFVERIFPYFSPGLYKDGKTSSPLTLYHHVP
Download sequence
Identical sequences H3CSP0
ENSTNIP00000003740 ENSTNIP00000011274 99883.ENSTNIP00000011274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]