SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CSP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CSP3
Domain Number 1 Region: 84-286,339-426,462-487
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.52e-56
Family Diacylglycerol kinase-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CSP3
Sequence length 500
Comment (tr|H3CSP3|H3CSP3_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000011277} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
SVPVSELVAVREEEEENRDDGSWKKIKESEGQDCGQAFTVLYVERCQRHRWRCAEVTFAC
ADEALCQLWVSSIREQLATNTSRPEHLLVYINPCGGKRKAEHIYELKVAPLFARAGIRTH
VIVTEYANHARDHLKTEAELKKFDGVVCVGGDGMFSEIIHGLIWRTQIDNGIDLNCPEET
LLPCSLRIGIIPAGSTDCICFATVGTNDPVTSALHIIVGDSQPLDVCSVHHNSLFLRYSV
SLLGYGFYGDVLTDSERKRWMGPARYDLSGVKMFLTHHYYEGTVSYLPARDAIGTPRDAA
RCRSGCAVCKHNGEKLSETAERYKMDGALDSGDHESDSEWRTIRGKFLAINGASMSCACP
RSPKGLSPAAHLADGTTDLILVRKCSRFDFLRHLLRHTSKDDQFDLNFVEVHRVRRFRFT
PRHCQSDSDLELDLRESGKRQIFSQICRDHPACGCTPAYSSWNCDGEILTHTAIDVRVHC
QLIKLFARGIEEPTVFEDLA
Download sequence
Identical sequences H3CSP3
ENSTNIP00000011277 ENSTNIP00000011277 99883.ENSTNIP00000011277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]