SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CSP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CSP8
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily PX domain 1.19e-17
Family PX domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CSP8
Sequence length 179
Comment (tr|H3CSP8|H3CSP8_TETNG) Sorting nexin 22 {ECO:0000313|Ensembl:ENSTNIP00000011282} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MIEVSIPSMEREVDDSGKSKKLFRVEVLFNERKHFVLRRTGEFQALHRKLKKIVQTPDFP
SKRSPHLRTKPLKQRRQELEDYIQEIIYHNEDVPQVLLDFLHVKHFHTRMSSIESLDNLD
SQDDGLQFPQRRVLGYFQDPFMTDCTTELPDVVVDGVLQGFYPRDIRVSFSPSLKPSPL
Download sequence
Identical sequences H3CSP8
ENSTNIP00000011282 99883.ENSTNIP00000011282 ENSTNIP00000011282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]