SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CSY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CSY9
Domain Number 1 Region: 46-284
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.48e-20
Family Ankyrin repeat 0.003
Further Details:      
 
Weak hits

Sequence:  H3CSY9
Domain Number - Region: 272-348
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0115
Family G proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CSY9
Sequence length 690
Comment (tr|H3CSY9|H3CSY9_TETNG) Transient receptor potential cation channel, subfamily V, member 1 {ECO:0000313|Ensembl:ENSTNIP00000011373} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
GQEAPKAPMDTDYQEEMEVPPDRIRFNPNFDKIRGEAHPKPDSNIYSITRLFEAVARRDT
DSLANLHRYLHQNMKKLSDPLSADQSHGKSALMKALLHLKDGKNETVELLIRISEQMGDL
DTFVNLAYTSAYYKGQTALHVAIERRSISYVKLLVSKGADVHARACGRFFQPHNGPNFYF
GELPLSLAACTNQPLMVDFLLDQRADPKQRDSYGNTVLHALVVVADNSEENTKFITSMYD
HILVTAARLYPKLKLEDIQNRNGLTPLTMATKTGKSGLFSHILKREFQDSDTKHLSRKFT
EWVYGPVTCFLYDLASVDSYHSGSALEILVYGSDIPNRLEMLQEELLAQLLESKWKRFAS
KMFLSNFIFYLVYLFVFTAVAYNKKDEQLAYTIEHTFWGYLYVSGQLLTALANGYFFIVG
ILDMRKKRLKLQALLIDGYYEILFLLQAFLFLISAVLYLSGQDQYLGFLVMSLALSWVNL
LYFSRGNQHMGVYSIMIQKMILSDILRFLFVYGVFLLGFSAAVVTLLIEPPVRNITSKGR
LLFSSVGPEECVKPTYRNISYTMLELFKFTIGMGDMEFTEDYKYKEVFYVLLIGYIILTY
ILLLNMLIALMNRTVETTAMESTSIWRLQRAITIMDMERRLPCCLRTWLRCGAEKNLGSE
QGDDRRWCFRVEEVNWNKWNIHLGKIDEDP
Download sequence
Identical sequences H3CSY9
ENSTNIP00000011373 ENSTNIP00000011373 99883.ENSTNIP00000011373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]