SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CT47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CT47
Domain Number 1 Region: 148-463
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-100
Family Protein kinases, catalytic subunit 0.0000000000478
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-23
Family Pleckstrin-homology domain (PH domain) 0.00000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CT47
Sequence length 482
Comment (tr|H3CT47|H3CT47_TETNG) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS01030073} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MNEVNIVKEGWLQKRGEYIKTWRPRYFILKSDGSFIGYKEKPDLNDQTSPPLNNFSVAGQ
SSIETKLKDPRPNTFVIRCLQWTTVIERNFHVDSNEDREEWMWAIQSVANSLKMREQDEE
EPMDLLGSPNESSLEEMEVATSKRCTRVTMNDFEYLKLLGKGTFGKVILVKEKATGVHYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTNDRLCFVMEYANGGELFF
HMSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDKDGHIKITDFGLCKE
GITPDATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEDIRFPRNLSPEAKSLLAGLLKKDPKQRLGGGPDDAKEVMTHKFFTNINWQDVVQ
KKLTPLFKPQVTSETDTRYFDEEFTAQTITLTPPDKYTSLDSEDPSQQAHFPQFSYSASI
RE
Download sequence
Identical sequences H3CT47
ENSTNIP00000011431 ENSTNIP00000011431 99883.ENSTNIP00000011431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]