SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CUV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CUV2
Domain Number 1 Region: 336-425
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 10-201
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.46e-20
Family Ankyrin repeat 0.0037
Further Details:      
 
Domain Number 3 Region: 514-574
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000247
Family RING finger domain, C3HC4 0.0031
Further Details:      
 
Domain Number 4 Region: 412-492
Classification Level Classification E-value
Superfamily RING/U-box 0.000053
Family RING finger domain, C3HC4 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CUV2
Sequence length 1017
Comment (tr|H3CUV2|H3CUV2_TETNG) RING-type E3 ubiquitin transferase {ECO:0000256|SAAS:SAAS00970528} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MGNTATKFRKALVGGDEGLAWQLYEGNPQFREGLDPNASYGEQYQHNTPLHYVCRHAMTR
LLRSFLFSKEGNPNKRNVHNETCLHVLCQGPQILLLSEGALSPRLARPHRDEQRRAECLQ
MILSWTGARLEGGQYEKANVNATDNHSSTCMHHAAAAGMKICVELLIQSEADLFVEDQEK
LTPCDHAERHNHTELALSLESQMVFSSSSCRHSNSDPQSESTLLQYKDPYEGLKLQDLRR
LKDMLIVETADMLQAPLFTAEALLRAHDWDREKLLEAWMLDADGCCQRSGVAMPTPPPSG
YNAWDTLPSPRTPKTPRSPLTLTLTSPTDSCLTPGEEGLSTCGICLCSISVFEDPVDMSC
GHEFCRACWEGFLNVKIQEGDAHNIFCPAYECYQLVPVHVIESVVSREMDQRYLQFDIKA
FVENNPAIRWCPAARCERAVRLTRPGPGDSDPQSFPLLPSPAVDCGRGHLFCWECLGEAH
EPCDCQTWRNWLQKVKEMKPEELAGVGEAYEDAANCLWLLTNSKPCANCKSPIQKNEGCN
HMQCAKCKYDFCWAWEEWKKHSSSTGGYYRCTRYEVIQQLEEQSKEMTAEAEKKHKSFQE
LDRFMHYYTRFKNHEHSYELEQKLLKTAKEKMEQLSRAFICREGTPPDTRFIEDGVCELL
KTRRILKCSYPYGFFLQQGSTQKEIFELMQTDLEMVVEDLAQKVNRPYLRTPRHKIISAA
RLVQQKRQEFLASVARGVAPNDSPEPPRRNYPGGSWDWEYLGFASPERFSNTRPCFEQEY
RRRHRPRRRGDMLSLHSLRSSSNTPETSRRGDASGADREPRKAARLPSSTGTCVCVVCFP
EGPERSEGLRRALGSLDEDDPNILLAIQLSLQESRRDQGLDGCLVRDGPAGARGPSFPTS
LADPPRPPNRTDSTYQSPRSASLPPPPPTLSAELLELGGSLMKLCLLSPEVEPEHLLSPV
IPRGGPFSPNDPQSLESLDPAASAQLLDNIMVWFNNNINPQNNPQSLALIPSPPTTE
Download sequence
Identical sequences H3CUV2
ENSTNIP00000012036 ENSTNIP00000012036 99883.ENSTNIP00000012036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]