SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CVW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CVW2
Domain Number 1 Region: 52-520
Classification Level Classification E-value
Superfamily Sema domain 7.06e-150
Family Sema domain 0.0000000841
Further Details:      
 
Domain Number 2 Region: 516-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000209
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CVW2
Sequence length 1104
Comment (tr|H3CVW2|H3CVW2_TETNG) Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D, like {ECO:0000313|Ensembl:ENSTNIP00000012396} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QRAALLLSELLLLLTASCTLLAVSFPEDSVPLDVVDAHFSRRYPVFRGRPSANESQHRLD
FQLMTKIQDTLFIAGRDQVYLVSLRESYRNEIIPYRKLTWRSGQADRDMCAVKGKHRDEC
HNFIKVLVPRNDDLVFICGTNGFNPMCRYYRLDNLEFDGEEISGLARCPFDSKQTNVALF
AEGKLYSATVADFQASDSVIYRSMGDGSALRTIKYDSKWLKEPHFLHAAEYGNYVYFFYR
EIAVEQSSLGKVVYSRVARICKNDVGGSQRVLEKHWTSFVKARLNCSVPGESFFYFDVLQ
SITDIININGVPSVVGVFTTQMNSIPGSAVCAFSMADIEKVFWGRFKEQKTQDSVWTPFP
EEKLPKPRPGSCAGHSPAASFKSSIEFPDDTLQFIKSHPLMDTAVPSLGDEPWFTKTRVR
YRLTALAVDNEAGPHKNYTVVFIGAESGVVLKVLAKTPSVSLDDSLLLEEIDVFNRAKCL
SNREDDKRVLSLHVDKEAHSLYVAFSSCVIRIPLSRCERHSSCHKSCIALRDPYCGWPHS
ACERIQPGVSAEYEQDVESGNTTHLGDCHAFLGSTSAPDYKSFGDPTSDMEFSSTPVTVQ
PNGPIHPPVLIPTQSPSSGPDPDHYGSGFVLQDDPATSNTLNSIPGGQEGVWDIQAGETN
QMVHMNILITCVFAAFLMGALLAGLIVFCYRDSVLRKPRHVHKDTESAPSCSDSTGSFVK
LNGLFDSPVKEYQTNIDTPKLFTNLLTNSKDLNTPNSDTKTMILRDSCQPPELAALPTPE
STPVLQQKGLQPITNQWERAQGKVSGPRKESNSSAKSPQFLPAPALLNPKSHQGHIALGH
SHIPSAVVLPNATHELSNMDGGSDTLPHSSEKRLKNPDSKGSRKDPKRSVDARNTLNDLL
KHLNDSVANPKAILQEEPGPRPRQHLTLEPMDELTEIPPVVPSREASLYSPSSSLPRHSP
TKRVDVPLPTTPTTPTGSLSMGGTLERQRGGYQLHRSASHRHSLSTSQNGVTMGVSVSRQ
HSMNRGGCMPPTPPSRIDSHSGVMGPGMHSPHSSISRQNSYNGHCSLPRTGLKRTPSLKP
DVPPKPNGFSPQTSQMRVVNKYNY
Download sequence
Identical sequences H3CVW2
ENSTNIP00000012396 ENSTNIP00000003980 99883.ENSTNIP00000012396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]