SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CW72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CW72
Domain Number 1 Region: 26-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.0037
Further Details:      
 
Domain Number 2 Region: 89-161
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000105
Family VWC domain 0.058
Further Details:      
 
Domain Number 3 Region: 194-237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000209
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CW72
Sequence length 331
Comment (tr|H3CW72|H3CW72_TETNG) Nephroblastoma overexpressed {ECO:0000313|Ensembl:ENSTNIP00000012506} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=NOV OC=Tetraodon.
Sequence
LSERALFVLLFTAQVLTLAWSQDCPRRCQCPDEPPTCPPAVPLILDDCACCLVCARQRGQ
ACSDMSPCDTRKGLRCDYAKDVRKRTGLCVAHGGHVCVLDGSVYQNGQTFIPSCKYQCMC
WDGQITCVPRCNLDMMLPGPDCPMPRRVQVPGECCEKWVCDPQAEASALGGFAMAAYRQE
ETVRFDAWDSSLNCIEQTTEWGACSQTCGVGVSTRVTNKNRRCEMVKQTRLCMIRPCADQ
LDRTRLRGSKCQRVVRSGTAVRLSHKNCTSIQAYTPRYCGSCTDGRCCTPHRTKTALVDF
QCTNGKSARRPVMVILTCVCHTHCPRDNAVW
Download sequence
Identical sequences H3CW72
99883.ENSTNIP00000012506 ENSTNIP00000012506 ENSTNIP00000012506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]