SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CWN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CWN4
Domain Number 1 Region: 287-458
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-41
Family SPRY domain 0.00053
Further Details:      
 
Domain Number 2 Region: 43-98
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000366
Family B-box zinc-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CWN4
Sequence length 488
Comment (tr|H3CWN4|H3CWN4_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000012668} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VCCDSCLDCPSGATKTCLTCLVSFCEAHLRPHLLNAKFQKHRLVDPLHDTDCRVCEVHCL
PFMRFCLKDSCCLCPDCERHQHEGHPTISVREARSGIEAELQKKCEEISERVSDAERAVE
QLKSNRSFIRAAVQEAYVVVEQQFALLRAAIKEARKQEVEALEGEKRAALRQAESIQAHV
EQRRAELSRILTEMNKLSGRELSDVDFVQEYGEWKKGAADLSLPTVPVSRMDHFTSYKEV
VVDATRELCGLILSYREKTSLTWKHVECAKASGTGSSPSALPDPESREDFLQYWRSLTFD
PDTTHHFLRIMEDNKKLINTSPWQHSYPDHPDRFDHWHQALSAGSLYQGRHYIEAELGGE
GAHVGLAYKGIKRKGKQRASCITGYAFSWCVGRDGRGFSAWHANAETPLAVGGVGTVGIY
VDFQRGCLSFYDVTGGMKLLHVYRTNFSEPLYLTAWLSKNSDFIHLADPGSCPPAAEKPA
PELRMNSP
Download sequence
Identical sequences H3CWN4
99883.ENSTNIP00000012668 ENSTNIP00000012668 ENSTNIP00000012668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]