SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CWN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CWN9
Domain Number 1 Region: 166-362
Classification Level Classification E-value
Superfamily E set domains 9.8e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000765
Further Details:      
 
Domain Number 2 Region: 64-182
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-24
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CWN9
Sequence length 433
Comment (tr|H3CWN9|H3CWN9_TETNG) Potassium inwardly-rectifying channel, subfamily J, member 2b {ECO:0000313|Ensembl:ENSTNIP00000012673} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
GERADHRYSIVSSEEDGMKLAAVAVPNGYGNGNVDKGHAERQHQSRFVRKGAHCNVQFIN
MSEKGQRYLADIFTTCVDIRWRWMLLVFCLSFLLSWLFFGLVFWMVALSYGDLDSKTQKC
VSNVDSFTAAFLFSVETQTTIGYGYRYVTEECPIAVFMVVFQSIVGCIIDAFIIGAVMAK
MAKPKKRNETLVFSYYATVAMRDSKLCLMWRVGNLRKSHLVEAHVRAQLLKSRTTAEGEY
IPLDQVDIDVGFDSGLDRIFLVSPITIVHEIDEDSPFYEMSKEDLQTSEFEIVVILEGMV
EATAMTTQCRSSYVAGEILWGHRFEPVLFEEKNYYKVDYSRFDNTYEVPSTPVCSARELA
EKMSNPSSSRNSFCYENEVALEKVELEDEESGAARGDEVGAFEDTAAGVVLDSECNLDSV
SLESRPLTAESEI
Download sequence
Identical sequences H3CWN9
ENSTNIP00000012673 99883.ENSTNIP00000012673 ENSTNIP00000012673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]