SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CX67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CX67
Domain Number 1 Region: 322-368
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000785
Family TSP-1 type 1 repeat 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CX67
Sequence length 803
Comment (tr|H3CX67|H3CX67_TETNG) Thrombospondin, type I, domain containing 1 {ECO:0000313|Ensembl:ENSTNIP00000012852} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
HDALSSASVFVDYSADSDGGTISSATLSLVNMETNTTVLSRTLPSNQRFGRVEFNCSCFL
YAGTFRFLLRVTRTTAVLRANGTGDRRTEGTARWWSSELQVHWPTFHIAVERTGNHSESF
QVGISTNEHFQACSYIVDSALFLEVSYMEYNQIGRKSIAKVRARTRHPIKALQSQSVELP
CVFPFSEKDFIQVALRSPHAAQEVKSSGALYLSRIFSYQLLVDNSNSYRSGCEGTMTVRL
MTPPCVHISGKVLLYRDAGSGQEPTSPPLAFNWLANGENETEFNCSLFYPGRNEYCFRFV
FNFSRSSSPAHTCLAVHRSTELWGPWQPWSLCSVSCGEGVRERVRECLLPGLGGMQCTGI
VKEQSLCSLEDCGASVRPAPSPSAPVGITPLGVNMVVVLGIALCLAVILSTVVVTVWRKF
CQTPQCSSAHRGSMHSPAGRKLSDEASICGNSLQRPSVSDGPGTLRATGASAAQGSAPVL
QNLPASHALVIPVSPDPERLSPTCQKMLPTVFGYRLAQQQLKEMKKKGLKEATQLYHVSS
SPVNDTLVEISASPTSSPIPTPTGLIHTAQPLSSQEASPSRFPTPASFPEPTVEMVERSG
FMGPRGREGGGEAATKGSYHRNPYFRRTSSFNDTKPQLLSSGQFRERSMTQVIQIPLLLC
ARGIFTWSRLKNTGTNTSSLSTYLKHTSQDLSEEKQRSSEAGIGQGISGIGGPAPGPPSL
STDAAERAEQNWNRRGPSPIHRNMLARKLKAAQAGSVSKGRQRSSTFSVSSAQQRTGRCR
SLPMSGDGSHYRLSEAEQRMLDL
Download sequence
Identical sequences H3CX67
ENSTNIP00000012852 ENSTNIP00000003134 99883.ENSTNIP00000012852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]