SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CX95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CX95
Domain Number 1 Region: 27-170
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.12e-17
Family Ankyrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CX95
Sequence length 818
Comment (tr|H3CX95|H3CX95_TETNG) Transient receptor potential cation channel, subfamily C, member 6a {ECO:0000313|Ensembl:ENSTNIP00000012880} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RRQALRGPAYMFSAPSYSLSEVEQRFLEAAEYGNIPEVRRMLLHVPNLNINAVDYMGQNA
LQLAVANEHLEVTELLLGRADLARVGDALLLAISKGYIRITEALLSHPAFRDARRLTASP
AQADMLDDFYAYDEDGTRFSHDVTPLILAAHCQEYEIVHTLLSKGARIDHPHDYFCGCDS
CNYQQQYDSFSHSRSRINAYRGLASPAYLSLSNEDPVLAALELSNELAVLADIEKEFKNE
YCCLSSQCKDYVVGLLDLCRSTEEVEAILSGETDTDDAYSPPGRPSLTRLKLAIKYELKK
FVAHPNCQQQLLSIWYENLPGLRQQTTAVKLLVVMAVAIGLPGLALAYWITPCSRVGKIM
RSPFMKFVAQASSFTIFLGLLILNAADRFAGTTLLANMTHQHYHQHTGGPRPDPLLLYRM
TTTPFTWMEILIISWIIGMIWAEVKEIWSQGPGEYVLEPWNFLDFGMLAIFLASFSCRFS
ILRHVEAAQTFVYTQHYPTLINVTLPPEIHYFTLARIHWLPSDPQLVSEGLYAVAVVLSF
SRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFLAFMIGMFNLYSYYLGAKQNDA
FTTLEESFKTLFWAIFGLSEVRSVVVNNGHKFIENTGYVLYGVYNVTMVIVLLNMLIAMI
NSSFQEIEDDADVEWKFARAKLWFSYFEEGRTLPVPFNLIPSPKSVLGLATCVRTLILRL
VRRHSEEKTGTQLNQVRNRLGDNSGSYSASNTTSRYQKIMKRLIKRYIIKAQADRESDEI
TEGELKEIKQDISSLRYELLEEKAQNMETLDALLRRMG
Download sequence
Identical sequences H3CX95
ENSTNIP00000012880 99883.ENSTNIP00000012880 ENSTNIP00000012880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]