SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CXH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CXH4
Domain Number 1 Region: 179-435
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-42
Family YWTD domain 0.0000258
Further Details:      
 
Domain Number 2 Region: 55-91
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000106
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 91-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000775
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 12-47
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000038
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  H3CXH4
Domain Number - Region: 132-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00011
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CXH4
Sequence length 438
Comment (tr|H3CXH4|H3CXH4_TETNG) Si:dkey-258f14.3 {ECO:0000313|Ensembl:ENSTNIP00000012959} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RFRCDEMSCHNCTAFSCGQADKCLSRTQLCDGRADCRDGRDESPKLCASSRPNAQACKSS
EFRCGDGPCVAQTYRCDNWKDCADGSDEVDCDQNECAVDNGGCSHGCRDLPLGFICECPR
DMVLVGEYQCEEVDACLDADVCDQVCIPANGSLTCGCHQDYKMSPTTGECKAKGDEARVV
FTSSQGLRWTSISGGESGEPAQQFPGPGLVVGLAANGTLYWAPQGCGTIYRVSMNERNGD
PLPALRVQGPVSGLAVDWIHRLLYWASAGSGSVHVGLLDGSAQRALVAGLQTPSAVAVDP
LHRLLFWAQSGDSPKIERSGLDGRDRKALVTHSIRHPVALSLDLPRQLLYWADQGAKTIS
RVNFEGRHRRTVVESNGYLDRPFGLAVFEGFVYWSDAATGSICRASKHHGRNFTVLLSNA
NSPGGVAIVQSALQPEGT
Download sequence
Identical sequences H3CXH4
ENSTNIP00000012959 99883.ENSTNIP00000012959 ENSTNIP00000012959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]