SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3CXS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CXS3
Domain Number 1 Region: 372-504
Classification Level Classification E-value
Superfamily TIMP-like 1.57e-26
Family Netrin-like domain (NTR/C345C module) 0.026
Further Details:      
 
Domain Number 2 Region: 180-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 3 Region: 236-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000148
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 4 Region: 299-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  H3CXS3
Domain Number - Region: 37-136
Classification Level Classification E-value
Superfamily Sialidases 0.0561
Family Sialidases (neuraminidases) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CXS3
Sequence length 506
Comment (tr|H3CXS3|H3CXS3_TETNG) Netrin 5 {ECO:0000313|Ensembl:ENSTNIP00000013058} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
PIDLTCWTGGKGSDAGEWTLTVPLGRRFEITYISMQFCQHRDPSEPVSISILKSMDYGRS
WRPMQHYSSDCRRNFGLPPQTVAHSRHQETEPLCSDPRPLQRQRGGMVLAFSTLDGRPSS
PDFDHSHTLQDWVTATDIRVVFHRVSKDTSTATFSSQDQELQPATQVPLALSDLQVGGRC
KCNGHASKCRRDDDGRAACVCEHHTAGPDCDVCEDFYFDRPWHRATPTQPNPCIACDCNG
HSNKCRFSMEVFQQSGRHSGGVCLKCRHNTAGRHCQYCQKGFTRDHSKPLHHRAACQPCQ
CHPLGAVGRWCNQTSGQCLCREGVTGLRCNRCAPGYKQGKSPLRPCILIPCLMPPPSLPP
PGSASAEECVSYCQPSQLKVRMNLETYCLKDYVLKVQVRGMERSGPWWQFSIAVQTVFRE
GSASRVRKGPHSLWVPDRDLRCGCPALHVGRTFLLIGTVEGERAWGPEESRLVADRSTLA
LQWREHWGHKLRGFRGQDKRGRCPAE
Download sequence
Identical sequences H3CXS3
ENSTNIP00000013058 ENSTNIP00000013058 99883.ENSTNIP00000013058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]