SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CY88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CY88
Domain Number 1 Region: 148-317
Classification Level Classification E-value
Superfamily E set domains 5.13e-47
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000336
Further Details:      
 
Domain Number 2 Region: 41-168
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-21
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CY88
Sequence length 342
Comment (tr|H3CY88|H3CY88_TETNG) Potassium inwardly-rectifying channel, subfamily J, member 1a, tandem duplicate 6 {ECO:0000313|Ensembl:ENSTNIP00000013223} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MFRFVSKCFRDCLAERRHRRTRLVTKDGRCNIEYGNIKYSNHFALLADFWTTFVEIRWRF
VLFLFIAAFTLSWFLFGLLWYWIARTNGDLAWQNPPSNHTPCVDNVVGLTTAFLYSIETQ
TTIGYGGRALTHLCPGAVSLLVIQSLIGAIINCFMCGVILSKISLPTQNPDDGSQIYGKL
LRTTNTPDGETIIMDQVNIEFMVDAGKDNLFFVCPLTLYHVIDKSSPFFDMAVDTLHKQE
FELVVFLDGTAESTSSSCQVRTSFIPQEIMWGYNFLPIISRSKEGRYRVDFSNFSKVVPV
ATAHCAYCFHNIKGHHHHSRDGHDNKGFEVIEIQDPPSVTKM
Download sequence
Identical sequences H3CY88
99883.ENSTNIP00000013223 ENSTNIP00000013223 ENSTNIP00000002395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]