SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CYR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CYR6
Domain Number 1 Region: 51-240,270-376,473-571
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.59e-60
Family LacY-like proton/sugar symporter 0.059
Further Details:      
 
Weak hits

Sequence:  H3CYR6
Domain Number - Region: 400-433
Classification Level Classification E-value
Superfamily Plexin repeat 0.0955
Family Plexin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CYR6
Sequence length 613
Comment (tr|H3CYR6|H3CYR6_TETNG) Solute carrier family 2 member 13 {ECO:0000313|Ensembl:ENSTNIP00000013401} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=SLC2A13 OC=Tetraodon.
Sequence
MGERRKKVNDGGERSLIRAPSSGSISSQDLERAARKQFQQDVTPGFVYVLAAFSAMGGFL
FGYDTGVISGAMLLLKKELELSALWQELLISSTVAAAALSALLGGFLNGLFGRRVCILLA
SFFFTVGGIVLSTAPGKEVLLAGRLIVGVGLGVACMTVPVYIAEASPPHLRGQLVTVNTL
FITGGQFTASLVDGAFSYLQHDGWRYMLGLSVLPAALQFIGFLFLPESPRWLIQRGLTQK
ARRVLSQIRGNQNIDEEYDSIKNSLDEEESGGGNDGPVIWRMLTYPPTRRALLVGCGLHM
FQQVSGINTIMYYSATILQMSGVRDDKLAIWLAGLTTLTNFLFTLLGVWLVERVGRRKLT
LGSILGTCLSLSLLAVGFLMSAQHSPPVTLHPTHPSLANSTCSKYQLCEPCMLDPECGFC
YRENGSALFASSCVPVDKASTERAAWGRCSNTSLMRDQTFWAYNYCPTSYSWLVLLGLVL
YLAAFAPGMGPMPWTINSEIYPLWARSTGNACAAGVNWTFNILVSLTFLHLAQYFTYYGA
FFLYSSMALLGFFFIYGCLPETKARRLEEIEALFENRLCSCGTSDSDEGRQVEYIRVKGS
NYHLSDNDASDVD
Download sequence
Identical sequences H3CYR6
ENSTNIP00000013401 ENSTNIP00000013401 99883.ENSTNIP00000013401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]