SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CZA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CZA1
Domain Number 1 Region: 360-414
Classification Level Classification E-value
Superfamily UBA-like 0.000000000779
Family UBA domain 0.00086
Further Details:      
 
Domain Number 2 Region: 445-481
Classification Level Classification E-value
Superfamily UBA-like 0.00000699
Family UBA domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CZA1
Sequence length 485
Comment (tr|H3CZA1|H3CZA1_TETNG) Ubiquitin associated protein 1 {ECO:0000313|Ensembl:ENSTNIP00000013586} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MATRKSGSDAYNNGPISYLDDVPFKINDKFRCPAKVGLPVGFCPPDCVSLLMDTQYDFSL
ERRSVLWGMELAEARAAEARAQEAAAKQEAESRERSQVQDADGGGGKKALPAAEDQDSLP
PAVNPVMAGLSHGAILTPLPAPSFGPRKAQPSTPQSHNLNLADFEREEDPFDKLELKTLD
DKEELRNILQSQPQPLPPPPPPSVSPPVLPQSGSASRGNSPSPPGISTSLTAKPGFPHKP
NGLVGLLDMDSVGPPGRAGLDTDDRPCNIRSLSFPKLSDSGDLEPARYRAPPLPVPVPLK
NLPNGSPSAAPRNQIIVVQETPNNTKSGAPKPCSITSFAGKKLKRCCCSPRQVNLGSGSS
GLPCGGALLSMTPSERQCAETLVGMGYSYEGVLRAMQRQGQNVEQVLDYLFLHTRLCERG
FDAGAVEECLEMYQCSEEKALQFLELMSRFGEMGFERDAIKEVLLVHNNDQDKALEDLMA
RAAAS
Download sequence
Identical sequences H3CZA1
ENSTNIP00000013586 ENSTNIP00000013586 99883.ENSTNIP00000013586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]