SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CZC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CZC9
Domain Number 1 Region: 554-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-68
Family Protein kinases, catalytic subunit 0.0000596
Further Details:      
 
Domain Number 2 Region: 163-509
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.45e-66
Family Ankyrin repeat 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CZC9
Sequence length 942
Comment (tr|H3CZC9|H3CZC9_TETNG) TNNI3 interacting kinase {ECO:0000313|Ensembl:ENSTNIP00000013614} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
CAKPASDPEEYATKLRAATREKLKKFNSLRGRQVQPGEFWDVVVLTAVDGDQRGAYELQM
AEKVKRKELPRGPHYKIFSDPPGCKIGNGGSTLYALQQLSDAYGEALSSLRVLLIHADEW
KKKVGESYAVIIERLDDDLQLKDSELADLRLAFSSDEAFQKVNLSYRTEKGLSLLHLCCV
CEGSKAHIRTLILKGLRPSRLSRNGFTALHLAAYKDNAELVTALLHGGSDVQQVGYGALT
ALHVATLAGHHEATDILLQHGANVNVQDAVFFTPLHIASCYGHEQVAKLLLKFGADENVS
GEVGDRPLHLAAAKGFLSIVKLLVEEGSKAKVNAKDNEDHIPLHFSARFGHHEVVRFLLQ
GNFDVQPHAVNIYGDTPLHLACYNGKFESVKEIVQLSGTDGLSKENIFSETVLHRQCVHY
GKDLEMVKFLLSQNAMSINHQGRDGHTALHSACFHGHIRLVQFLLDNGADMNLVACDPSR
SSGEKDEQTCLMWAYEKGHDAIVTLLKHYKRPDDSPCNEYSQPGGASDGSYVSVPSPLGK
IKSMTKEKAEVLLLRVSLPSHFHLQMSELEFNEIIGSGSFGRVYRGKCRNKIVAIKRYRA
NTYCSKSDVDMFCREVSILCCLNHPCIIQFVGACLDDPSQFAIVTQYVSGGSLFSLLHEQ
KRLIDMQSKLIIAIDVAKGMEYLHNLTQPIIHRDLNSHNILLYEDGHAGLADFGESRFLQ
SVDEDNMTKQPGNLRWMAPEVFTQCTRYSVKADMFSYALCLWELFTGEIPFAHLKPAAAA
ADMAYHHIRPPIGYSIPKPISTLLMRGWYACPERREEFGEKEDVYNENECEKQLMAPASS
NSSGSLSPSSSSDCLLGRGGPGRSHVAALRSRFELEYALNTRAYAYWSQSERRRASGGLS
LEEVRKNMQRSPIDRNGYVSDPMSTMRCSSSFSSGGSFEDSN
Download sequence
Identical sequences H3CZC9
99883.ENSTNIP00000013614 ENSTNIP00000013614 ENSTNIP00000013614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]