SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CZD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CZD9
Domain Number 1 Region: 1148-1349
Classification Level Classification E-value
Superfamily vWA-like 9.94e-57
Family Integrin A (or I) domain 0.00021
Further Details:      
 
Domain Number 2 Region: 2269-2481
Classification Level Classification E-value
Superfamily vWA-like 6.23e-56
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 397-585
Classification Level Classification E-value
Superfamily vWA-like 6.52e-55
Family Integrin A (or I) domain 0.00018
Further Details:      
 
Domain Number 4 Region: 70-286
Classification Level Classification E-value
Superfamily vWA-like 2.37e-53
Family Integrin A (or I) domain 0.00044
Further Details:      
 
Domain Number 5 Region: 2498-2703
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-31
Family Laminin G-like module 0.054
Further Details:      
 
Domain Number 6 Region: 1908-2079
Classification Level Classification E-value
Superfamily Fibronectin type III 5.83e-23
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 7 Region: 697-864
Classification Level Classification E-value
Superfamily Fibronectin type III 5.23e-22
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 8 Region: 1726-1897
Classification Level Classification E-value
Superfamily Fibronectin type III 1.28e-21
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 9 Region: 300-390
Classification Level Classification E-value
Superfamily Fibronectin type III 2.64e-20
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 10 Region: 2093-2178
Classification Level Classification E-value
Superfamily Fibronectin type III 2.02e-19
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 11 Region: 1535-1698
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-19
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 12 Region: 1059-1151,1348-1428
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-18
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 13 Region: 877-963
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-17
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 14 Region: 602-689
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-16
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 15 Region: 1450-1534
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000571
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 16 Region: 979-1053
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000138
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 17 Region: 2181-2268
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000794
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 18 Region: 4-77
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000182
Family Fibronectin type III 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CZD9
Sequence length 3044
Comment (tr|H3CZD9|H3CZD9_TETNG) Collagen, type XII, alpha 1b {ECO:0000313|Ensembl:ENSTNIP00000013624} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
FKILSESSVQMSWTKPRSRIQGYRIQVSGGPEEAEREFTLPPAATKTSISDLSADVDYVV
SISAFAGSQESLPISGQLTPRGSSRTADASDQISRCLFLECSAGAAADLLFLVDGSWSVG
KANFKHIRAFLSAAASAFQIGQDRTRVGVVQYGSDARVEFRLDAHPSRPALLRAIGTLPY
MGGDTRTGHALKFLLEKSLTEEAGARKDFPKVLVVVTDSKSVDPVENSAGRLRSAGVEVF
VLGVGQADEAEMKQIASTPYRNHVYSVATFQTIKSVQRELISQLCAAVEDQLNSLVSGEE
AVEPPSNLQVLEVASKSMRVTWDPPGGQVSGYKVQMIPLLAGSRRQEVYVGGGQTSVVVR
DLSPDVEYQVSLYALKGLTPSEAVSVLQKTEPVKVSVECSLGVDVQADVVLLVDGSYSIG
LANFAKVRAFLEVLVNTFDIGPDKVQISLVQYSRDPHTEFYLDSHHNLEAVVTALRTFPY
RGGSTNTGRAMTYVRETVFQASRGARAHVPRVTILITDGKSSDAFQEPAANLRNSDVEIF
AVGVKDAVRSELEAIANAPAETHVYTVEDFDAFQRISTELTQSICLRIEQELQIINQRRL
VQPRDLYFSDVGPRSFRASWEINANNVESYLVQFRPTEGEDSHYVSMSVPGDVLTALLPH
LTPLTRYEVSVSAQYAKGTSLPVTGYGTTAEERGSVQNLKVTEESPQSFRVSWRAAPGAV
ARYRLTYQPAGAGEAQLEAFTAGPELTMVLQDLQPRTTYRVTVTPEYKGGPGGPQQTDGT
TREAKGSPGGLRVFDQTVSSMKVSWEPAPGDVLQYRLAYRASSGGPRKEVSVKGTNTAIV
LKKLQPGTEYDITVSARYRSGLGEALKGRGATLEEVGPPRNLVTSEVTDSSFTASWTAAP
GNVRMYQIRWKSMFSEESGQMTVPGHTTTALLDGLSPETLFQVSVVANYEDRDSRALTGQ
ETTNLCRSEKPGSVGGDRPHHMKVTWAPAPGKVSQYRLKFGPVGGAEEVSLKVPGSGTSA
VLKELQPVTTYHISVQPIYKHGEGKARQGVGTTLSPFKTPRNLQLSEPTKTSFRVSWDPA
PGDVKGYKVTFHPSGNDVDLGELLVGPYDSTVVLEELRAGTKYSVAVFGMFEGGQSTPLV
GEERTTLSDAPDLPFPDASDPQCKTNAKADIILLVDGSWSIGRMNFKIIRNFIARTVSVF
NIGPGRVQIGLAQYSGDPKTEWHLNAHPTKESLLDAVANLPYKGGNTMTGMALNYILQNN
FKTNVGMRPGARKIGVLITDGKSQDDVVFNSQNLRDNDIELYAIGIKNADENQLRSIASD
PEQIHMYNVRDFKFLADIVKNVTSNLCNSVKGPGGEVEAPTDLVTFDQTHHSFQVSWTEP
SNPPEKFLLTYTKTAGGDVQEVLVDGSVTTQLLDGLSPQTEYVLSVYSLIGENRSEPLSG
TDLTLPAPSADNLEVYEQTSSSMRVKWDRVEEATGYVLLYRPVHQPQLEKEVRFGEDVTD
IQLGNLTPETEYFISLRALFGEAASDPLEGKGRTLPVPPAGNLRITDVTHSTMKLSWDAA
PGEVSRYLITYAPEEGDLREVEVGAKVTSLDLVGLISQTEYEVAVTPVYREGSGTPRLGT
AITEVVPAPKNLQFSEVSQSAFTVSWEHGAPDVALYRLSWSKRGENDDQDLILNNDATSH
RLDNLDLDTEYDVKVTAIYPDESESEDLLGSARTSHWNLVSDPTVPPAPPRNLRVFNATT
SSLTAKWEAAPSPVQGYRLTYRPAGGGEPLTTQVSGMSTSTVLRDLQPDTKYTVTLVPGY
TEAEGKRSSANGKTKALGGVKNMQVTDPTTSSLKVRWDPAEGNVRQYRIFYVPAAGGAED
MEQVSGGSTSTNLRNLLSDTAYTVTVVPVYPEGEGLPQSDAGKTLPRTPPRNIQVYNPTA
DSLNVRWEPASGQVQQYRVAYTALRGASRPDSVLVPGNIRNTFLDNLIPDTPYSISVSAL
YADGEGSPVSDTGKTLPRAGPRNMRVFDPTTSSLIISWDHAEGPVRQYKISYSPMDRNPS
SRAETTSVPGNRNNARLENLRPDTAYSIRVEPLYPEGPGAELSGNGRTLTLMSPRNLRVS
DEWYTRFRVAWDPVPAPVEGYRLAYSPAGSAGPPVDLFVGDITSYTLHNLQPGTTYDVRV
VAQYTGGKSEPLAGQGTTLYLNVTNIETYNVDHDKFCIKWTPHRSATSYRIKLNPVDPSS
KGQHEITVSAGLPQYCFEGLSPDALYTATVFVQTPNLEGPGVSIREKTLVKPTPVPTLPP
TPSPPPTIPPAWAVCKGAKADLVFVIDGSWSIGEDSFTKVIHFVSGIIGAFDVIGPSGMQ
VSFVQYSDNAKTEFKLNSYREKGVAMAALHLIRYQGGNTKTAGMALKHTYEKAFSLENGM
RRNVPKMVVVITDGRSQDEVKKSATKLQQAGYSVFAIGVADVDYNELQEIATKPSERHVF
VVDDFDAFDTIKENLINFICETATSSCPLIFLNGFTSPGFRMLEAFNLTEKTYSYTKGVS
MEPGSFNSFTSYRIHKNAFLTQPSADVHPDGLPHAYTIILMFRLLPDSPAEAFDIWQVSS
KDHKPETGVTVNPSRKTVSFYNKDERGEIQRVVFDGDQVKRIFHGSFHKLHILVSSTGVR
LNIDCQEVAEKEIKAAGNTSSDGYQVLGKMSKSVGATGESATFQLQMFDIVCSLAWTSRD
RCCDLPSRRDELKCPALPNACSCTSAASGEPGPQGPVGAPGSRGTRGERGEAGPVGPTGP
RGDTGPPGPMGLPGPQGPSGLSIPGEPGRPGPKGDAGDGGLPGQKGSPGAPGAVGPIGPA
GVRGPQGKDGAIGPRGPPGPMGPPGSPGVPGTAGKPGNTGDTGPPGAVGPKGDKGERGDF
APQNMMRVIARQVCENLFSAQMTRINTLLNQVPSGVYSSNKPGPPGPPGEPGRQGPPGEP
GSAGRSGFPGTPGLPGQQGDRGPPGEKGDRGETGVGQKGPRGPAGPPGEGRTGSAGPPGT
VGPRGPPGRPGYAGVRGPPGPPGYCDSSQCVGIPYNGQGYGGKH
Download sequence
Identical sequences H3CZD9
99883.ENSTNIP00000013624 ENSTNIP00000013624 ENSTNIP00000013624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]