SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CZE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CZE1
Domain Number 1 Region: 374-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.09e-39
Family SPRY domain 0.00063
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 4.24e-21
Family RING finger domain, C3HC4 0.0083
Further Details:      
 
Domain Number 3 Region: 137-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.55e-17
Family B-box zinc-binding domain 0.0007
Further Details:      
 
Weak hits

Sequence:  H3CZE1
Domain Number - Region: 176-264
Classification Level Classification E-value
Superfamily Influenza hemagglutinin (stalk) 0.00401
Family Influenza hemagglutinin (stalk) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3CZE1
Sequence length 540
Comment (tr|H3CZE1|H3CZE1_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000013626} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAQKTVELDQEAFSCPICLNLLEDPVTIPCGHSYCMGCISAYWQEQEAHSCPQCRHSFTP
RPVLLKNTMLALLVEQLKQLGHQAAGERPAGAEDVACDVCTGTRLKAVKSCLVCLVSYCG
KHLQPHYQSATFEKHRLVDPTRRLQESLCPHHEEVMRMFCRTDQQLICYVCPVDEHKGHD
TVSAAAERTERQKELMEVQKNIQQRIQEREKDFQVLEEEVAAVNRSADTAVEDIDTFFTE
LLQLLDRRCSDGRQQVRNMQDSEVSQARGLQEKLQEEISELRRRNDQLQELFLTEDHNRF
LHSYPSLSHLREPADAAATQVPRPKHFEDMTVGLSKVQQQLESLLGQDWFQVPDTATAVV
PSQPPPLPQPRSRADFQTYSCRLTLDPETAHPMVTLSDCNRRATYMSDAVICVANRERFL
GWYQVLSKERMAGRCYFEVTRKGRVFVAVAYNSISRGHRSNESRLGFNRQSWALSCEKGT
CVFYHNTVATPLVGVGCSQIGVYVDHSAGILSFYGISSTTRLIHSIQTAFTEPLHAGIGF
Download sequence
Identical sequences H3CZE1
99883.ENSTNIP00000013626 ENSTNIP00000013626 ENSTNIP00000013626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]