SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3CZK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CZK6
Domain Number 1 Region: 446-571
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-30
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 239-345
Classification Level Classification E-value
Superfamily Cadherin-like 5.37e-29
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 347-450
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-22
Family Cadherin 0.004
Further Details:      
 
Domain Number 4 Region: 130-237
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-22
Family Cadherin 0.004
Further Details:      
 
Domain Number 5 Region: 562-671
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000144
Family Cadherin 0.0031
Further Details:      
 
Domain Number 6 Region: 33-104
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000385
Family Cadherin 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CZK6
Sequence length 988
Comment (tr|H3CZK6|H3CZK6_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000013692} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MDTLGLKTGLCGKWQIMYCSVLCACLLDAVWGQIRYSIPEELEHGAFVGNIAEDLGLDAD
KLSARRFRIVSGGKRQYVEMNLENGVLFVNERIDREELCEQSLSCAFHLQVVIENPLELY
RVELEILDVNDNSPSFPWTEFNLDISESAAPGSRFPLESAQDSDVGSNSLRTYLLSVNEH
FLLDIQTRSDGSKFAELVLQTPLDREQQSAHQMVLTAVDGGAPERSGTAQIDITVLDAND
NAPVFDQSFYRVRLAENAPKGTVVIKLNASDLDEGPNADITYSFSGHAPLKVRQLFSVDP
RTGEIKVKGVIDYEKARMHEIYVQAKDKGPSAVAVHCKVLVNVLDKNDNIPDVILTSVST
PVQEDAPPGTVIAVISVTDKDSGENGNVDCEISHHVPFQLHSSFKNYYTLVTSDFLDRES
VAEYNITLTARDMGSPPLFTRKTILVQVADVNDNAPRFKQPSYTVYLTENNAPGASICAV
TALDPDSGQNAYISYSVHEGDIQGMPVSTYVSINSDNGNIYALRSFDHEQLKNFQITVQA
QDAGLPPLSNNVSIVIFVLDQNDNPPVIVSPVSRNGTAPDQAVPRSADAGHLVTKVRAVD
ADAGQNSRLLYQMIQATDPTLFSVALYTGEVRTIRQLVEKDPTRHRLVILVKDNGQPALS
ATVSISLSVVDSLPESKPDQSDLSQSSRHSSNLTLYLIVSLGAVSFTFLVAIIVLVVVQR
LKGRPSNKSSLPFIPSLCGCCRRTETRATTEVFRKSNLNVRMASGPEAAGSGPIPQVYCY
KMCLTPESKKHDFMFLKPCSPVLSAQQNNAKSTDYLTSGWSTLDRSELVKNRALTPNEPK
APNADWRYSASLRAAGVQSSVHMEEASVMQGAQGMLVQNWPTVSSAADGEGGGELSPPVG
AGVNSNSWNFRYGAAQAYYPPQPLKPGEIPPEAFIIPGSPAIISIRHDAGPVDDKGEFIS
FGKKDEAKKKKKKKKDKKDKKEKGKDDE
Download sequence
Identical sequences H3CZK6
ENSTNIP00000013692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]