SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D0D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D0D6
Domain Number 1 Region: 14-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-72
Family BAR domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 277-345
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-22
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3D0D6
Sequence length 350
Comment (tr|H3D0D6|H3D0D6_TETNG) SH3 domain containing GRB2 like 2a, endophilin A1 {ECO:0000313|Ensembl:ENSTNIP00000013972} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSVAGLKKQFHKATQQKVSEKVGGAEGTKLDDDFTEMEKRVDVTSRAVLDIMTKTTEYLQ
PNPATRAKMSMMNSMSRMRGQEKGPGYTQTEAILGESMQKFGRELGEESSFGLALVDIGE
AMRDGEVKDALDMEVKQNFIDPLQNLHEKDLKEIQHHLKKLEGRRLDFDYKKKRQAKVTE
DELKQALEKFDDSKEIAEQSMFNLLESDIEQVSQLAALVQAQLEYHSRSAEILTQLSSKI
DERIREASGKPRKEFVPKPRTSLDFSISENHNGGIHGARSPARSPAPMDQPCCRALYDFD
PENDGELGFKEGDIITLTNKIDDNWFEGMLHGNSGFFPINYVDTLVPLPH
Download sequence
Identical sequences H3D0D6
ENSTNIP00000013972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]