SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D0U8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D0U8
Domain Number 1 Region: 454-745
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.95e-72
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 8-122
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-29
Family Spermadhesin, CUB domain 0.0000297
Further Details:      
 
Domain Number 3 Region: 171-280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-27
Family Spermadhesin, CUB domain 0.0000387
Further Details:      
 
Domain Number 4 Region: 118-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 5 Region: 380-441
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000278
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 6 Region: 357-387
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000946
Family Complement control module/SCR domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D0U8
Sequence length 746
Comment (tr|H3D0U8|H3D0U8_TETNG) Mannan binding lectin serine peptidase 1 {ECO:0000313|Ensembl:ENSTNIP00000014134} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=MASP1 OC=Tetraodon.
Sequence
AAAQTASLSQMFGSLQSPNFPDPYPRETRLRWNLSVPAGFRLRLYFSHFHLEPSYLCEYD
SVKVEAEGEVLALFCGKEDTDTESVPGQQVIGSPGNALSLLFTSDFSDEERYSGFQAHYS
AVDVDECSERADEDLSCDHHCHNYLGGFYCSCRYGYLLHSDKRTCRVECSDGVFTERSGV
LSSVDFPSPYPKSSECVYRIQVEPGLRLRLQFDARFDVEDHPDVSCPYDHVMNKAGTRTF
GPLCGNRSPGEIQTDTNAATVSFHSDNSGENLGWKITYTSTTEVRCEAPAAPPPRPAPAR
PIRVLGGRPGGVQLRAWTPSAEGRPPPGPPPGPPPGPPPAFMSSLVSRFQDGRVLSRYQL
HCQADGSWSDGPPRCHAADCGSPALVPGADVVFGSHDNSTLLGSTLSYVCREDGSNSSYR
CGPSGSWVSPELGTGLPSCLPEPGRVVQEVLSRCCVRSHCGRPSRPLPALMKRIVGGRSA
EPGLFPWQVLLSVEDLSRVPKDRWFGSGALLSESWVLTAAHVLRSQRRDASVVPVAPQDV
KVFLGLHDAGDKRWATNRSVERIVLHPNFQADSYDSDIALLRLSQGAELSELIQPVCLPR
LRPQDAWRWPLPNSLGVVAGWGISSPNGSSPGSPSSLSSDPGLTSDLLQYVKLPVVSQDE
CESTQYASRSARYNITANMFCAGFLEGGRDTCLGDSGGAFVMEDGASRWAVFGLVSWGGP
GACGSQGLYGVYTRVAAYVEWILEQV
Download sequence
Identical sequences H3D0U8
99883.ENSTNIP00000014134 ENSTNIP00000014134 ENSTNIP00000014134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]