SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3D1B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D1B0
Domain Number 1 Region: 440-615
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.59e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000116
Further Details:      
 
Domain Number 2 Region: 617-716
Classification Level Classification E-value
Superfamily E set domains 8.9e-29
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D1B0
Sequence length 1106
Comment (tr|H3D1B0|H3D1B0_TETNG) Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3a {ECO:0000313|Ensembl:ENSTNIP00000014296} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MTTANCPGNEELDFRLIFGEDGQQQPLGPADWPSDDDLEPDDNTSFYILNVGQPQSVVTN
HQPLGLPRHGMQSHSQIISTSPRFQTHRPGSEPPGYETQDSKYGTSPLLSSAPLEAPKAF
ACPSIQITSISPSCQQEMDPNENALSANGPDRDFHGDRPLSRDHLYLPLDHAYRDSSLSP
SPCSSLSSRSWFSDASSCESFSHIYDDVDSELNEAAARFTLGSPLTSPGCASPQASGGVL
EEQPHWQHHHPTIVHQSHTINLSPRQSPCHSPRTSVTDENWLSPRPPSRPSSRPTSPCGK
RRHSSADLCYAGSLSPHHSPTATPGPSPRSSVTEDTWVGSPTVGMSPFSCCPSEADIPLK
TRKTSQDRTTMQTVKGELGLDEQGNMSPNLDSPSDEAMHSLKKDGPGEQFLSVPSHFSWN
KPKPGHTPIFRTSSLPPLDWPLPSQFGQFELKIEVQPKAHHRAHYETEGSRGAVKASSGG
HPIVKLIGYNEKPVNLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEILVSCTKVLE
IPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRKNTRVRVVFRVHIPQPNGKVLSL
QAASIPVECSQRSAQELPQVDKSSLTSCLVSGGEEMVISGSNFFPESKVIFLEKGPDGRP
QWEVEAKIIREKSQGSCIVVEVPPYHSKTVASAVQVQFYVCNGKRKRSQSQRFTYLSVTV
RQEHRDELDLPPVPPISMPLAHASSLVCTQLPSPEQGHPSDTFCSGPGLLPLQPPCPPLG
SPSFQHLPHLQGHSLQHHPADCHMPFHPNSVPAPARPSYQPMQHSHSHNLPFNGQPSLPS
QGYERMPFQHSPSSGPHPMAMGMVYSSSPCSSPSAPSTPGSNPIVGSPQSQQNLLNPSSP
HLHALGGYHCSPNPTPVPSPPGHPLVVQHSSQLQRAMGYHPIGQRSASCPTPSSAPPPPP
PPRMVPSPHSGPSSPQLHSLPYQSPTSSSPTPGQQQHSGQPSPQATSPVMAGLSPATAAG
PLVHPLSPQGPFPTDGERLNIKQEPEEREPTFRSIGLQDITLDDVNEIIGRDMSQFSPTL
SLSSSLSPSAPCPLPELGFIGRFSGS
Download sequence
Identical sequences H3D1B0
99883.ENSTNIP00000014296 ENSTNIP00000014295 ENSTNIP00000014296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]