SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D1B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D1B7
Domain Number 1 Region: 7-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.46e-48
Family FCH domain 0.0056
Further Details:      
 
Domain Number 2 Region: 367-423
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-18
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D1B7
Sequence length 423
Comment (tr|H3D1B7|H3D1B7_TETNG) Proline-serine-threonine phosphatase interacting protein 1b {ECO:0000313|Ensembl:ENSTNIP00000014303} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RMTLLMFKDSFWGCDFTNHAGYEAVIRRLQDGRQMCKDVEELLKMLNATKTNRFRILTQQ
ILRRVFFHISFVDLKASFEEIKSQLENIGNFHIQLSDTLKEEVKKIEVFRERQKEQKKKF
QSIMEKIQRKKVSLYKKTMESRKNYQLRCKEADEAEQTAQKTNLAAKNSDKIRHRANQCR
QNAIEAEKLHSSTIVSLESVRKDWEEAHKSTCEVFQQLEMDRIAVLRCALWDHCNYLSVQ
CVKDDEKQSYEEVRRKLEKCDIITDINCFIRMKSTGTKPPEPVLFESCYEAGRSTNDNHQ
APSADWDHLARFGSICMSTDHLAPEPMSISTDSLQMSQSSSLNDTGDTDAGYAPLRFGRS
QAEVSADEERYSVMFDYKAQEIDELSVSTGETVQVLEQGQDGWWMVAKNGMKGLVPGNYL
KKI
Download sequence
Identical sequences H3D1B7
ENSTNIP00000014303 ENSTNIP00000014303 99883.ENSTNIP00000014303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]