SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D1D5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D1D5
Domain Number 1 Region: 408-719
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.19e-48
Family Eukaryotic proteases 0.00041
Further Details:      
 
Domain Number 2 Region: 102-217
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 3 Region: 281-342
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000025
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 4 Region: 214-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000356
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3D1D5
Sequence length 720
Comment (tr|H3D1D5|H3D1D5_TETNG) Peptidase domain containing associated with muscle regeneration 1 {ECO:0000313|Ensembl:ENSTNIP00000014321} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
SLCLDYRYLYHHCPGPEWNVMCRGCCEYDVIRCKCPRGHHVGYAVPCCRNAVNECDPCII
HPGCSIFENCKRCNNGTWSAQDDFFISGEYCSECRPGWSGGDCMKCGGVIHKKQGHLVLE
SYPNNARCEWTIQVDRPFAVELRFMMLSLEFHHSCQYDYVEVRDGDSISSRVIGRFCGNS
RPPPVYSSGSSLHVLFVSDGYKNFDGFFATFQEISACSSSPCFHDGTCILDSSHTYRCAC
LGGYTGKNCEHAVESYRDLKPIFQGSPGNSKYTITQGKKSCPPLPHLHHGYHRVVPGAKP
EAVEFFCNHSYALSGDALRSCQSDGTWSGRQPVCVRACREPKVSELVRQRVLPPQAPFRK
TPVHKLYSGLSPNLQSDSHTKGPPALSSLPQGFHQLYTHIEYECASQYYQHFGSSRRTCL
KTGKWSGRHVSCSPVCGKHPTFDPERPADSHWPWLAAIYRRSNNRVGKKDLESDWQLVCS
GVLVNQRSVVVAAHCVTELGKVYPLETAKLKVVVGKHFREDQREDKGPQHLRVDSIAVHE
NYDPHVLDSDVAVIRLLDKAKIGEKVAPLCLSDSQEDLETTSEQGLVTGWSPVPDPSLGP
EEKARVGLVHLAHVVPCEQQYARNGVPVSVTDNMLCASQKPDYGSNICPSDMGGILILPP
LTDSRTSSHRPSQGKGEDKGRWRLLGLVSFGYDQGECDPDLYTVYTHVANFKDWVEGRMK
Download sequence
Identical sequences H3D1D5
99883.ENSTNIP00000014321 ENSTNIP00000014321 ENSTNIP00000014321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]