SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D1I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D1I0
Domain Number 1 Region: 14-303
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.26e-66
Family FCH domain 0.0047
Further Details:      
 
Domain Number 2 Region: 411-475
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3D1I0
Sequence length 477
Comment (tr|H3D1I0|H3D1I0_TETNG) Protein kinase C and casein kinase substrate in neurons 2 {ECO:0000313|Ensembl:ENSTNIP00000014367} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MSGSYDDSINDVSSDSFWEVGNYKKSVKRVDDGNRLCNELMNCIHERARIEKAYAQQLTE
WGKRWRQLIEKAGPQYGTLERAWTSLCTEAEKVSELHMEVKAALMGEDFEKLKNWQKDAY
HKQMIGGFKETKEAEDGFRKAQKPWAKKLKEVEAMKKSYHTACKEEKLAASRETNSKLES
NNPEAQKKLQEKLEKCQQEVQKTKERYEKSLEELDKLTPQYMENMEQVFEQWQQFEDKRI
RFFREVLLEVKQHLDLSTNHRFQTIYHTLEDTISATDAEEDLKWFRTNQGPGMPMNWPQF
EDWSMDLNRTLSKREKKRPSEGVHLTGISQTGSDQPVQPAKSSSSLNTPAKTAPAGSNPV
KQQTTVSHIIVNKEDLKTCSAGSAEKTPDWSDEDSSGNPFSANGNGNPFEDEPTSPVISV
PVRALYDYEGQEQDELSFKAAGYEFTKIGEEDDQGWCKGRLKDGQIGLYPANYVEDI
Download sequence
Identical sequences H3D1I0
ENSTNIP00000014367 99883.ENSTNIP00000014367 ENSTNIP00000014367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]