SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D1M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D1M5
Domain Number 1 Region: 54-214
Classification Level Classification E-value
Superfamily E set domains 1.11e-53
Family RhoGDI-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3D1M5
Sequence length 218
Comment (tr|H3D1M5|H3D1M5_TETNG) Unc-119 homolog 1 {ECO:0000313|Ensembl:ENSTNIP00000014413} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RKAGGGMLKKLKSRRSQTEKWPAVTEDELRALGSSITPDHVLGLRAITEDYLCKAEDNVY
NVDFTRFKIRDLETGTVLFEIAKPPGSAPVDSEEDGLDVDASAGRFVRYQFTPAFLKLCT
VGATVEFTVGDRPINSFRMIERHYFQGRLLKSFDFDFGFCIPNSRNTCEHIYEFPQLPDD
LIRQMVARPYETRSDSFYFVDNKLIMHNKADYAFNGGL
Download sequence
Identical sequences H3D1M5
99883.ENSTNIP00000014413 ENSTNIP00000014413 ENSTNIP00000014413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]