SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D1Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D1Q0
Domain Number 1 Region: 31-164
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.19e-31
Family Ankyrin repeat 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3D1Q0
Sequence length 180
Comment (tr|H3D1Q0|H3D1Q0_TETNG) Ankyrin repeat domain 39 {ECO:0000313|Ensembl:ENSTNIP00000014438} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MMTPGDHRCSCCSGPVSSVHQTLHEMDFERGIWSAALHGDLQRVRSLVQKGTQPNLKDTA
GYTAQHYASGGGHVAVCAFLLEVGACASPQTPGGATLHRAAYCGHVDVVGLLLEHGANPS
LRDGDGATPLHKAAARGHREVCGLLLQSCPTLCSVTDNKLQLPFVDVLPNNSGCSSLTKA
Download sequence
Identical sequences H3D1Q0
ENSTNIP00000014438 ENSTNIP00000014438 99883.ENSTNIP00000014438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]