SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3D1T1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D1T1
Domain Number 1 Region: 347-524
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-48
Family SPRY domain 0.00061
Further Details:      
 
Domain Number 2 Region: 5-76
Classification Level Classification E-value
Superfamily RING/U-box 8.39e-17
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 90-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000549
Family B-box zinc-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3D1T1
Sequence length 525
Comment (tr|H3D1T1|H3D1T1_TETNG) Tripartite motif containing 65 {ECO:0000313|Ensembl:ENSTNIP00000014469} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
AQNLNLTCAICLERFSIPVTIPCGHTFCQICISKYWDGDVKPAKHQCPICKTEFDTKPML
RRNVSLSVLTEAANSTTCREALLRGGDGARAMQLCDRHKKPLVYYCKQDRTPVCHECGIC
DCKNHEKVLLETEKENQELLLERKINEVEKLVKETEEKIADLAENISQAKVSFEQTSVWV
SAKFSSMMKVLGEKQEATEQFIHQQQEEAIGEAEARLCELQAHSRTLRESRSQIKAVHNL
SDTLRLQQNGQLYCSKQESMVIEVPRLKDVATDVKPNLQDRLNAVTEILSRMSKLVSDDL
DKAVSSTVGQDKLPLFSRVSSGQEASSSCGSQSSCPQSPWVKPVLSRRILRYRCSLTFDP
RTANGNLFLSQENRRAEHLTSGPRPVPPHEARFDHTWQVLCFQGFTHGQHYWELEVSKPW
AYLGVTYESIPRKEKGRRCMVGMNELSWSLQLDQHQLSAWHNGQRETLAGPAQSSRIGML
LDYEAGTLTYYGDGQTRLHAFHCAFTQELFPACWIGEGVSITLCS
Download sequence
Identical sequences H3D1T1
99883.ENSTNIP00000014469 ENSTNIP00000014469 ENSTNIP00000014469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]